GlamCO TB-500 lyophilized research peptide vial
99%+ Purity
Verified by HPLC
Home / Catalog / TB-500

TB-500

$85.00
Made in USA
cGMP Compliant

Thymosin β4-derived peptide supplied as a lyophilized powder for in vitro tissue regeneration and actin-binding research. Full-length Thymosin β4 (Tβ4) is a 43-amino-acid G-actin-sequestering peptide; "TB-500" is also used in literature for the 7-residue active fragment (LKKTETQ, residues 17–23) — see FAQ for the version supplied.

Tier Quantity Discount
Most Popular 3 - 5 10%
Max Savings 6 + 15%
Secure Checkout | Third-Party Tested | Free Shipping $100+
Sterility & Endotoxins PASSED
Net Content & Purity PASSED
Third-Party Lab Verified

Independently Tested. Verifiably Pure.

Every batch of TB-500 is sent to an accredited independent laboratory before it ships. Here is exactly what we screen for - and the certificate that proves it.

What We Test Every Batch For

HPLC Purity Analysis
Confirms the peptide is ≥99% pure
Mass Spectrometry
Verifies the exact molecular identity
Heavy Metals Screening
Lead, arsenic, cadmium & mercury - Pass
Endotoxins (LPS)
Bacterial endotoxin levels - Pass
Sterility Testing
No microbial contamination - Pass
TFA Content
Residual trifluoroacetic acid - Not Detected
Net Peptide Content
Actual peptide mass per vial verified
📄
200+
Tβ4 Publications
PubMed-indexed actin/regeneration studies
🧬
43
Amino Acids (Tβ4)
7-aa active fragment LKKTETQ (res. 17-23)
🧪
~0.7
µM G-Actin Kd
Sequesters 40-50% of cellular G-actin
🛡️
99%+
Purity Verified
HPLC tested, COA included
Molecular Mechanism

How TB-500 Works

Three documented mechanisms from peer-reviewed Thymosin β4 research

Actin Dynamics

G-Actin Sequestration & Cell Migration

Full-length Tβ4 is the principal intracellular G-actin–sequestering peptide in mammalian cells, binding monomeric actin with a Kd of approximately 0.7 µM and buffering 40–50% of the cellular G-actin pool. Controlled release of actin monomers to profilin drives lamellipodial extension and directed cell migration in regenerating tissue (Safer 1991; Goldstein, Hannappel & Kleinman, 2005).

  • High-affinity G-actin sequestration (Kd ~0.7 µM)
  • Regulates lamellipodia/filopodia formation at the leading edge
  • Actin-binding domain maps to residues 17–23 (LKKTETQ)
Repair Signaling

Tissue Repair & Angiogenic Pathway Research

Tβ4 forms a functional complex with PINCH and integrin-linked kinase (ILK), activating the Akt survival pathway. In murine myocardial infarction models, Tβ4 enhanced cardiomyocyte survival, promoted endothelial migration, and improved cardiac function (Bock-Marquette et al., Nature 2004). Tβ4 also stimulates angiogenesis and accelerates dermal and corneal wound closure (Malinda et al., FASEB J 1999; Philp et al., 2003).

  • Activates PINCH/ILK/Akt cell-survival signaling
  • Stimulates endothelial cell migration and tube formation
  • Accelerated re-epithelialization in dermal & corneal wound models
Cytoprotection

Anti-Inflammatory & Cytoprotective Research Mechanism

Tβ4 suppresses NF-κB activation and downregulates pro-inflammatory cytokines (TNF-α, IL-1β, IL-6) in injury models, while upregulating laminin-5 and key matrix components. It also scavenges reactive oxygen species and reduces apoptosis in ischemic and chemically injured tissues (Sosne et al. 2010; Crockford et al., Ann NY Acad Sci 2010).

  • Inhibits NF-κB nuclear translocation in inflamed cells
  • Downregulates TNF-α / IL-1β / IL-6 in injury models
  • Reduces ROS and caspase-3–mediated apoptosis
Preclinical Outcomes

What Research Has Shown

Reported magnitudes of effect from peer-reviewed Tβ4 studies

Dermal Re-epithelialization vs Saline (Day 7, Malinda 1999) +61%
Cellular G-Actin Buffered by Tβ4 40–50%
Cardiomyocyte Survival Post-MI (Bock-Marquette 2004) Improved
Reported HPLC Purity per Batch ≥99%
Investigational Fields

Research Applications

Primary areas of TB-500 / Thymosin β4 investigation

Musculoskeletal

Tendon & Ligament Recovery Research

Preclinical models report Tβ4 promotes tenocyte and myoblast migration and accelerates structural recovery of injured tendon, ligament, and skeletal muscle via actin-regulated cell motility and laminin/MMP expression.

Philp & Kleinman 2010 ↗
Cardiac Repair

Cardiac Repair Preclinical Models

In murine permanent LAD ligation, Tβ4 administration upregulated ILK/Akt activity, enhanced early cardiomyocyte survival, reduced scar volume at day 28, and improved ejection fraction — establishing Tβ4 as a benchmark molecule for cardiac repair research.

Bock-Marquette et al. 2004 ↗
Wound Biology

Wound & Tissue Regeneration Research

Topical or systemic Tβ4 increased dermal re-epithelialization by up to 61% at day 7 vs saline, with elevated angiogenesis and collagen deposition in full-thickness wound models in rodents.

Malinda et al. 1999 ↗
Cell Biology

Actin Dynamics Cell Biology

A standard reagent for studying G-actin sequestration, profilin handoff, lamellipodial dynamics, and cytoskeletal remodeling in non-muscle cells. Useful for in vitro motility, scratch-wound, and Boyden-chamber assays.

Goldstein, Hannappel & Kleinman 2005 ↗
Technical Specifications

Compound Information

Technical specifications and analytical profile

Chemical Name
Thymosin β4 (Tβ4) — full-length 43-mer (primary entry); LKKTETQ fragment (residues 17–23) is the synthetic active heptapeptide also marketed under the TB-500 name
Sequence (Full Tβ4)
Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 aa, N-acetylated)
Sequence (Active Fragment)
Ac-LKKTETQ-OH (7 aa heptapeptide, residues 17–23)
Molecular Weight
~4963.4 Da (full-length Tβ4) · ~889.0 Da (Ac-LKKTETQ fragment)
Molecular Formula
C₂₁₂H₃₅₀N₅₆O₇₈S (full-length Tβ4)
CAS Number
77591-33-4 (full-length Thymosin β4)
Form
Lyophilized powder
Purity
≥99% (HPLC verified)
Testing
Third-party HPLC, Mass Spec, Endotoxin
Storage (lyophilized)
-20°C for long-term stability
Storage (reconstituted)
2-8°C, use within 14 days
Solubility
Bacteriostatic water for reconstitution
COA
Included with every order
Common Inquiries

Frequently Asked Questions

Common questions about TB-500 research parameters

Both labels appear in the research-peptide market. "TB-500" historically describes a synthetic 7-amino-acid fragment of Thymosin β4 corresponding to residues 17–23 (Ac-LKKTETQ), which contains the conserved actin-binding domain. However, many commercial suppliers — including most "TB-500" research peptides shipped today — actually supply full-length 43-aa Tβ4 (SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, MW ≈ 4963 Da). This product page documents both forms; the lot-specific COA included with your order will state which species is supplied and its measured mass by HPLC-MS.
Full-length Tβ4 binds monomeric G-actin 1:1 via its N-terminal α-helix (residues 1–14) and the central LKKTETQ stretch (residues 17–23), with a Kd of ~0.7 µM. This sequesters 40–50% of cellular G-actin and inhibits nucleotide exchange, keeping actin polymerization-incompetent until profilin extracts the monomer for filament assembly. Downstream, Tβ4 engages a PINCH/ILK/Akt complex to support cell survival and migration.
No. Thymosin β4 has progressed through clinical trials for indications including dry-eye, pressure-ulcer, and epidermolysis bullosa wound research, but no formulation is FDA-approved for general medical use. This material is research-grade and is supplied for in vitro investigation only.
Cell-migration scratch-wound assays, Boyden-chamber motility assays, endothelial tube-formation studies, in vitro fibroblast/keratinocyte re-epithelialization models, ex vivo myocardial ischemia-reperfusion preparations, and biochemical actin-polymerization assays measuring G-actin sequestration kinetics.
Lyophilized TB-500 should be stored at -20°C protected from light and moisture for long-term stability. Once reconstituted with bacteriostatic water, aliquots should be refrigerated at 2–8°C and used within 14 days. Avoid repeated freeze-thaw cycles, which degrade peptide integrity.
No. This product is sold strictly as a research chemical for in vitro laboratory use only. It is not a drug, supplement, or medical device, and is not intended for use in humans or animals. Purchasers represent that they are qualified researchers and will comply with all applicable laws regarding handling, storage, and disposal.
Academic Literature

Sources & References

Peer-reviewed Thymosin β4 publications

PUBMED

Thymosin β4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair

2004 · Bock-Marquette I et al. · Nature 432(7016):466–472
PMID 15565145 ↗
PUBMED

Thymosin β4 accelerates wound healing

1999 · Malinda KM, Goldstein AL, Kleinman HK et al. · J Invest Dermatol / FASEB J
PMID 10469335 ↗
PUBMED

Thymosin β4 promotes angiogenesis, wound healing, and hair follicle development

2004 · Philp D, Goldstein AL, Kleinman HK · Mech Ageing Dev 125(2):113–115
PMID 15037013 ↗
PUBMED

Thymosin β4: a multi-functional regenerative peptide. Basic properties and clinical applications

2010 · Crockford D, Turjman N, Allan C, Angel J · Ann NY Acad Sci 1194:179–189
PMID 20536426 ↗
PUBMED

Thymosin β4: structure, function, and biological properties supporting current and future clinical applications

2005 · Goldstein AL, Hannappel E, Kleinman HK · Trends Mol Med 11(9):421–429
PMID 16099219 ↗
PUBMED

The interaction of thymosin β4 with actin: kinetic and structural data on a high-affinity G-actin complex

1991 · Safer D, Elzinga M, Nachmias VT · J Biol Chem 266(7):4029–4032
PMID 1999401 ↗