GlamCO GLP2-TZ
99%+ Purity
Verified by HPLC
Home / Catalog / GLP2-TZ

GLP2-TZ

$85.00
Made in USA
cGMP Compliant

GLP2-TZ (teduglutide-class peptide) is a DPP-IV-resistant GLP-2 analog supplied as a lyophilized powder for in vitro intestinotrophic and mucosal-research applications. The Gly² substitution extends preclinical half-life relative to native GLP-2.

Tier Quantity Discount
Most Popular 3 - 5 10%
Max Savings 6 + 15%
Secure Checkout | Third-Party Tested | Free Shipping $100+
Sterility & Endotoxins PASSED
Net Content & Purity PASSED
Third-Party Lab Verified

Independently Tested. Verifiably Pure.

Every batch of GLP2-TZ is sent to an accredited independent laboratory before it ships. Here is exactly what we screen for - and the certificate that proves it.

What We Test Every Batch For

HPLC Purity Analysis
Confirms the peptide is ≥99% pure
Mass Spectrometry
Verifies the exact molecular identity
Heavy Metals Screening
Lead, arsenic, cadmium & mercury - Pass
Endotoxins (LPS)
Bacterial endotoxin levels - Pass
Sterility Testing
No microbial contamination - Pass
TFA Content
Residual trifluoroacetic acid - Not Detected
Net Peptide Content
Actual peptide mass per vial verified
📄
100+
Published Studies
GLP-2 analog preclinical research
🧬
33
Amino Acids
[Gly²]GLP-2(1-33) sequence
⏱️
~2h
Preclinical Half-Life
vs. ~7 min for native GLP-2
🛡️
99%+
Purity Verified
HPLC tested, COA included
Preclinical Mechanism

How GLP2-TZ Works

GLP-2 receptor signaling studied across intestinotrophic, mucosal-barrier, and enteroendocrine preclinical research models

GLP-2R Agonism

GLP-2 Receptor Activation

GLP2-TZ is a synthetic [Gly²]GLP-2(1-33) analog that binds the GLP-2 receptor (GLP-2R), a class B GPCR localized to intestinal subepithelial myofibroblasts, enteric neurons, and enteroendocrine cells. Receptor activation triggers downstream cAMP/PKA signaling that propagates indirectly to crypt enterocytes via paracrine mediators such as IGF-1 and ErbB ligands in preclinical models.

  • Selective GLP-2R agonism on subepithelial fibroblasts
  • cAMP/PKA second-messenger cascade
  • Paracrine IGF-1 and ErbB-mediated effects on crypt cells
DPP-IV Resistance

Gly² Substitution & Extended PK

Native GLP-2 is rapidly inactivated by dipeptidyl peptidase-IV (DPP-IV), which cleaves between Ala² and Asp³, yielding a preclinical plasma half-life of approximately 7 minutes. Substituting Ala² with Gly² blocks DPP-IV cleavage, extending the preclinical half-life to roughly 2 hours and enabling sustained GLP-2R engagement in research models.

  • Ala² → Gly² blocks DPP-IV N-terminal cleavage
  • Preclinical half-life ~2 h vs. ~7 min for native GLP-2
  • Sustained receptor exposure in in vitro systems
Intestinotrophic

Mucosal-Trophic Pathways

In preclinical rodent and in vitro intestinal models, GLP-2R activation increases crypt-cell proliferation, villus height, mucosal mass, and small-bowel weight. Research models additionally describe reduced enterocyte apoptosis, increased intestinal blood flow, and reinforced tight-junction barrier function.

  • Increased crypt-cell proliferation and villus height
  • Reduced enterocyte apoptosis in research models
  • Enhanced barrier and tight-junction integrity
Preclinical Outcomes

What Research Has Shown

Reported magnitudes from rodent and in vitro GLP-2 analog studies

Villus Height Increase (rodent SBS models) ~40%
Crypt Depth / Crypt-Cell Proliferation ~50%
Small Intestinal Mass Increase ~30%
Mucosal Barrier Integrity (TEER) Improved
Investigational Fields

Research Applications

Primary areas of GLP-2 analog investigation in preclinical and in vitro models

Receptor Biology

GLP-2 Receptor Biology Research

Tool for studying GLP-2R class B GPCR pharmacology, receptor localization on subepithelial fibroblasts and enteric neurons, and cAMP/PKA signaling dynamics in cultured intestinal cells.

Drucker & Yusta 2014 ↗
Intestinal Adaptation

Intestinal Adaptation Preclinical Studies

Rodent short-bowel and resection models use [Gly²]GLP-2 to probe intestinotrophic adaptation: villus elongation, crypt proliferation, and enhanced nutrient absorption following massive small-bowel loss.

Drucker et al. 1996 ↗
Mucosal Barrier

Mucosal Barrier Research

In vitro and rodent models examine GLP-2R effects on tight-junction protein expression, transepithelial electrical resistance (TEER), and barrier integrity under inflammatory and ischemic challenge.

Benjamin et al. 2000 ↗
Enteroendocrine

Enteroendocrine Pathway Research

Investigations of L-cell co-secretion of GLP-1/GLP-2, paracrine IGF-1 and ErbB ligand release, and crosstalk between proglucagon-derived peptides in enteric and metabolic preclinical systems.

Rowland & Brubaker 2011 ↗
Technical Specifications

Compound Information

Technical specifications and analytical profile

Chemical Name
[Gly²]GLP-2(1-33) (teduglutide-class peptide)
Sequence
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD (33 aa; Ala² → Gly² substitution)
Molecular Weight
~3752 Da
Molecular Formula
C₁₆₄H₂₅₂N₄₄O₅₅S
Form
Lyophilized powder
Purity
≥99% (HPLC verified)
Testing
Third-party HPLC, Mass Spec, Endotoxin
Preclinical Half-Life
~2 hours (vs. ~7 min for native GLP-2)
Storage (lyophilized)
-20°C for long-term stability
Storage (reconstituted)
2-8°C, use within 14 days
Reconstitution
Bacteriostatic water for in vitro reconstitution
COA
Included with every order
Common Inquiries

Frequently Asked Questions

Common questions about GLP2-TZ research parameters

GLP2-TZ is a teduglutide-class research peptide: a synthetic 33-amino-acid GLP-2 analog ([Gly²]GLP-2(1-33)) corresponding to the sequence of teduglutide. "TZ" is supplier shorthand for the teduglutide framing. It is supplied strictly as a research-use lyophilized powder for in vitro and preclinical studies, not for human or animal consumption.
In preclinical models, GLP-2 analogs bind GLP-2R, a class B GPCR expressed on intestinal subepithelial fibroblasts, enteric neurons, and a subset of enteroendocrine cells. Receptor activation drives cAMP/PKA signaling and triggers paracrine release of factors such as IGF-1 and ErbB ligands, which mediate the intestinotrophic effects on crypt enterocytes observed in research models.
Native GLP-2 carries an Ala at position 2, which is the preferred N-terminal cleavage site for dipeptidyl peptidase-IV (DPP-IV). Replacing Ala² with Gly² removes that recognition residue and protects the peptide from DPP-IV inactivation. In preclinical pharmacokinetic studies this extends the plasma half-life from approximately 7 minutes for native GLP-2 to roughly 2 hours for the [Gly²] analog.
In rodent short-bowel, resection, colitis, and ischemia-reperfusion models, GLP-2 analogs increase villus height, crypt depth, crypt-cell proliferation, small-bowel mass, and mucosal weight. Studies also report reduced enterocyte apoptosis, increased intestinal blood flow, and improved barrier function via tight-junction protein modulation.
Typical research applications include rodent short-bowel syndrome and resection models, chemically-induced colitis (DSS, TNBS), intestinal ischemia-reperfusion injury, in vitro Caco-2 and enteroid barrier-integrity (TEER) assays, and GLP-2R signaling studies in cultured intestinal subepithelial myofibroblasts.
Lyophilized (freeze-dried) GLP2-TZ should be stored at -20°C for long-term stability. Once reconstituted with bacteriostatic water for in vitro use, store refrigerated at 2-8°C and use within 14 days. Avoid repeated freeze-thaw cycles and protect from light.
Academic Literature

Sources & References

Peer-reviewed publications and preclinical studies database

PUBMED

Physiological actions and therapeutic potential of glucagon-like peptide-2 in health and disease

2014 · Drucker DJ, Yusta B
View Source ↗
PUBMED

Induction of intestinal epithelial proliferation by glucagon-like peptide 2

1996 · Drucker DJ, Erlich P, Asa SL, Brubaker PL
View Source ↗
PUBMED

Glucagon-like peptide-2 secretion and metabolism

2011 · Rowland KJ, Brubaker PL
View Source ↗
PUBMED

Glucagon-like peptide-2 enhances intestinal epithelial barrier function

2000 · Benjamin MA, McKay DM, Yang PC, Cameron H, Perdue MH
View Source ↗
PUBMED

A novel analogue of glucagon-like peptide-2 (h[Gly2]GLP-2) protects against ischemia-reperfusion injury

1997 · Drucker DJ, Shi Q, Crivici A et al.
View Source ↗
PUBMED

Teduglutide, a glucagon-like peptide 2 analog: a review of preclinical and clinical pharmacology

2010 · Jeppesen PB
View Source ↗